Misplaced Pages

Talk:Sadhguru: Difference between revisions

Article snapshot taken from Wikipedia with creative commons attribution-sharealike license. Give it a read and then ask your questions in the chat. We can research this topic together.
Browse history interactively← Previous editNext edit →Content deleted Content addedVisualWikitext
Revision as of 20:20, 31 October 2018 editIn ictu oculi (talk | contribs)Autopatrolled, Extended confirmed users, Page movers, New page reviewers, Pending changes reviewers180,560 edits Redirect Sadhguru like Sadguru to Satguru← Previous edit Revision as of 16:43, 1 November 2018 edit undoRenamed user ExPsittacine (talk | contribs)16,254 edits Requested move 20 October 2018: reNext edit →
Line 334: Line 334:
*'''Comment''' in continuation of my Oppose vote above, I find that it is wrongly been claimed that Sadhguru is his most COMMONLY used name. This is not true. The subject is still commonly known as Jaggi Vasudev in the reliable mainstream media. called Jaggi Vasudev, called "Sadhguru Jaggi Vasudev".The word Sadhguru comes from "Satya" (truth) and (Guru) teacher, so it actually means, True Teacher, (as opposed to lots of Fake teachers out there). And it is interesting that This person likes to use the word for himself, kind of self glorification I would say. ] In ]s regional languages, it is quite common to add an extra h to Hindi words that have the letter t, So Satguru becomes a Sathguru/sadhguru. Sadhguru is actually a common name for Indian Gurus or spiritual leaders. Using this word to exclusively refer to Jaggi Vasudev is also inappropriate. ] is another such example, he is popularly known as but our article does not mention Sadguru in the title. --''<span style="text-shadow:0px 0px .3em LightSkyBlue;">]]</span>'' 14:32, 31 October 2018 (UTC) *'''Comment''' in continuation of my Oppose vote above, I find that it is wrongly been claimed that Sadhguru is his most COMMONLY used name. This is not true. The subject is still commonly known as Jaggi Vasudev in the reliable mainstream media. called Jaggi Vasudev, called "Sadhguru Jaggi Vasudev".The word Sadhguru comes from "Satya" (truth) and (Guru) teacher, so it actually means, True Teacher, (as opposed to lots of Fake teachers out there). And it is interesting that This person likes to use the word for himself, kind of self glorification I would say. ] In ]s regional languages, it is quite common to add an extra h to Hindi words that have the letter t, So Satguru becomes a Sathguru/sadhguru. Sadhguru is actually a common name for Indian Gurus or spiritual leaders. Using this word to exclusively refer to Jaggi Vasudev is also inappropriate. ] is another such example, he is popularly known as but our article does not mention Sadguru in the title. --''<span style="text-shadow:0px 0px .3em LightSkyBlue;">]]</span>'' 14:32, 31 October 2018 (UTC)
**I remain neutral. We can find plenty of examples of sources using either name but not the other to refer to this person, but the relevant question is which is used ''most often'' to refer to him?. To that end, it's interesting to ] and for which I get 6.3M and 4M hits respectively, suggesting sadhguru is the most common. Unless, some of those references to sadhguru are not to this person, but I've yet to find a single such example. --] ] 18:25, 31 October 2018 (UTC) **I remain neutral. We can find plenty of examples of sources using either name but not the other to refer to this person, but the relevant question is which is used ''most often'' to refer to him?. To that end, it's interesting to ] and for which I get 6.3M and 4M hits respectively, suggesting sadhguru is the most common. Unless, some of those references to sadhguru are not to this person, but I've yet to find a single such example. --] ] 18:25, 31 October 2018 (UTC)
::: FYI, ] is a commonly found name in this country and makes that comparison rather pointless. Anyhow, as noted in my spiel, you should also be considering both "Sadhguru Jaggi Vasudev" and "Sadhguru" and "Jaggi Vasudev" which indicate that the term is being used as an honorific. This however does not really solve the current problems inherent with Google searches for such comparisons. This is because:
:::# Google search might return a result count, but you can only browse an insignificant percentage of them. AFAICT, you are limited to 10–11 pages or 100–110 results. There are similar limitations for Bing, Duckduckgo, etc. So you can't really check if there are false positives. Even in the first link you have provided, what I see is that the last 2 pages (i.e., , ) are essentially full of links from shaded.davemejiamasonry.com.
:::# Google also considers and returns results in Indic languages although this might be region-dependant. And again, as noted in my spiels, when Jaggi Vasudev's title is transcribed into Hindi, it becomes ''सद्गुरु'' (i.e., ''Sadguru'') or even ''सतगुरु'' (''Satguru''). IOW, Google also returns results for ''Sadguru'' and this includes all the Sadgurus and Satgurus out there as well as use of the word in songs and other media quite unrelated to any guru in particular. For example, of your search lists as it contains the song: ''तेरे चरणों में सतगुरु मेरी प्रीत हो भजन लिरिक्स'' (''tere charanon mein sa'''t'''guru meri preet ho bhajan lyrics'').
:::# And it's easy enough to find a number of references to other Sad'''h'''gurus besides Jaggi if you play with combinations of these honorifics. See for example, , , etc. There's even one resident here on Misplaced Pages: ].
:::# See also all the other limitations listed on ] (which needs to be updated).—] (]) <small>(please <u>ping</u> when replying)</small> 16:42, 1 November 2018 (UTC)


==Redirect Sadhguru like Sadguru to ]== ==Redirect Sadhguru like Sadguru to ]==

Revision as of 16:43, 1 November 2018

Articles for deletionThis article was nominated for deletion on 6 May 2010. The result of the discussion was keep.
This is the talk page for discussing improvements to the Sadhguru article.
This is not a forum for general discussion of the article's subject.
Article policies
Find sources: Google (books · news · scholar · free images · WP refs· FENS · JSTOR · TWL
Archives: 1, 2, 3
This article is written in Indian English, which has its own spelling conventions (colour, travelled, centre, analysed, defence) and some terms that are used in it may be different or absent from other varieties of English. According to the relevant style guide, this should not be changed without broad consensus.
This article must adhere to the biographies of living persons (BLP) policy, even if it is not a biography, because it contains material about living persons. Contentious material about living persons that is unsourced or poorly sourced must be removed immediately from the article and its talk page, especially if potentially libellous. If such material is repeatedly inserted, or if you have other concerns, please report the issue to this noticeboard.If you are a subject of this article, or acting on behalf of one, and you need help, please see this help page.
This article has not yet been rated on Misplaced Pages's content assessment scale.
It is of interest to the following WikiProjects:
Please add the quality rating to the {{WikiProject banner shell}} template instead of this project banner. See WP:PIQA for details.
WikiProject iconIndia: Karnataka / Tamil Nadu Mid‑importance
WikiProject iconThis article is within the scope of WikiProject India, which aims to improve Misplaced Pages's coverage of India-related topics. If you would like to participate, please visit the project page.IndiaWikipedia:WikiProject IndiaTemplate:WikiProject IndiaIndia
MidThis article has been rated as Mid-importance on the project's importance scale.
Taskforce icon
This article is supported by WikiProject Karnataka (assessed as Mid-importance).
Taskforce icon
This article is supported by WikiProject Tamil Nadu (assessed as Mid-importance).
Note icon
This article was last assessed in April 2015.
Please add the quality rating to the {{WikiProject banner shell}} template instead of this project banner. See WP:PIQA for details.
WikiProject iconHinduism: Philosophy High‑importance
WikiProject iconThis article is within the scope of WikiProject Hinduism, a collaborative effort to improve the coverage of Hinduism on Misplaced Pages. If you would like to participate, please visit the project page, where you can join the discussion and see a list of open tasks.HinduismWikipedia:WikiProject HinduismTemplate:WikiProject HinduismHinduism
HighThis article has been rated as High-importance on the project's importance scale.
Taskforce icon
This article is supported by the Philosophy task force (assessed as High-importance).
Please add the quality rating to the {{WikiProject banner shell}} template instead of this project banner. See WP:PIQA for details.
WikiProject iconReligion: New religious movements High‑importance
WikiProject iconThis article is within the scope of WikiProject Religion, a project to improve Misplaced Pages's articles on Religion-related subjects. Please participate by editing the article, and help us assess and improve articles to good and 1.0 standards, or visit the wikiproject page for more details.ReligionWikipedia:WikiProject ReligionTemplate:WikiProject ReligionReligion
HighThis article has been rated as High-importance on the project's importance scale.
Taskforce icon
This article is supported by New religious movements work group (assessed as High-importance).
Please add the quality rating to the {{WikiProject banner shell}} template instead of this project banner. See WP:PIQA for details.
WikiProject iconBiography
WikiProject iconThis article is within the scope of WikiProject Biography, a collaborative effort to create, develop and organize Misplaced Pages's articles about people. All interested editors are invited to join the project and contribute to the discussion. For instructions on how to use this banner, please refer to the documentation.BiographyWikipedia:WikiProject BiographyTemplate:WikiProject Biographybiography
Please add the quality rating to the {{WikiProject banner shell}} template instead of this project banner. See WP:PIQA for details.
WikiProject iconYoga High‑importance
WikiProject iconThis article is within the scope of WikiProject Yoga, a collaborative effort to improve the coverage of Yoga, Hatha yoga, Yoga as exercise and related articles on Misplaced Pages. If you would like to participate, please visit the project page, where you can join the discussion and see a list of open tasks.YogaWikipedia:WikiProject YogaTemplate:WikiProject YogaYoga
HighThis article has been rated as High-importance on the project's importance scale.
Please add the quality rating to the {{WikiProject banner shell}} template instead of this project banner. See WP:PIQA for details.
WikiProject iconSaints High‑importance
WikiProject iconThis article is within the scope of WikiProject Saints, a collaborative effort to improve the coverage of Saints and other individuals commemorated in Christian liturgical calendars on Misplaced Pages. If you would like to participate, please visit the project page, where you can join the discussion and see a list of open tasks.SaintsWikipedia:WikiProject SaintsTemplate:WikiProject SaintsSaints
HighThis article has been rated as High-importance on the project's importance scale.

One - the film

He is part of this film's quest and journey, too.

Austerlitz -- 88.72.4.122 11:28, 23 May 2007 (UTC)

ONE : the Movie -, http://www.filmz.de/film_2007/one_der_film/ -- 88.72.4.122 11:39, 23 May 2007 (UTC)

-- 88.72.4.122 12:40, 23 May 2007 (UTC)

at the bottom you can find Sadhguru Jaggi Vasudev.

-- 88.72.4.122 15:12, 23 May 2007 (UTC)

http://www.heiligenlexikon.de/BiographienE/Elisa.html

Mercury claim softened

I have visited the Dhyanalinga temple, and it is true that followers claim that ancient alchemical techniques unknown to modern science were used to solidify mercury at room temperature. I state here no opinion on the truth or falsehood of that claim, but merely not that it is a rather extraordinary claim. Rather than our simply stating it to be true, I think we should "go meta" and state what is unquestionable: that followers claim it to be true.--Jimbo Wales (talk) 07:36, 25 March 2008 (UTC)

Okay, you're the boss. M.Nelson (talk) 06:15, 10 July 2008 (UTC)


Symbol

Austerlitz -- 88.75.193.211 (talk) 11:04, 5 December 2008 (UTC)

'Future events' section

In my opinion this section isn't appropriate for an encyclopedia. PhilKnight (talk) 8:33 am, 6 March 2010, Saturday (8 years, 7 months, 24 days ago) (UTC+5.5)

I strongly agree. Boromir123 (talk) 8:40 am, 6 March 2010, Saturday (8 years, 7 months, 24 days ago) (UTC+5.5)

Article Issues

Several templates regarding the article's quality and notability have been placed on the page. The edit unfortunately does not identify what parts of the article are questionable. IMO this article does not deserve these templates as it is properly referenced, is NPOV, and the subject is notable. If there are any issues with the article, can someone please point out. The template was added from an IP, and not a registered user. I've left a PM but the IP doesn't seem to be an active user and has no other edits. Regstuff (talk) 02:31, 27 February 2013 (UTC)

  • Since this article has already been rated on the quality scale, there are sufficient reliable references for it, and it has also passed the notability test as seen on top of this talk page, I am removing the article issues templates since no specific issues have been raised either in the article or the talk page. If there are any issues, please raise them here. Regstuff (talk) 04:17, 3 March 2013 (UTC)

I've done some copy-editing on this. I'm new but I don't see any major issues aside from the need for editing, which I've made a start on. ~~— Preceding unsigned comment added by Zulfah72 (talkcontribs) 13:45, 17 October 2016 (UTC)

BLP issues

I understand that there are plenty of charlatans etc in the sphere that the subject of this article operates. However, dedicated "controversy" sections are not usually a good idea and especially so in biographies of living people. Worse still when they appear as a list and are legal allegations that don;t even end up in the court system. Is there no other way to handle the issues? - Sitush (talk) 04:03, 2 January 2014 (UTC)

Bad ISBN

Because it is causing a Checkwiki error #70: "ISBN with wrong length", I removed the ISBN from the entry:

Gnani Sannidhilo ISBN ISBN 978-81-879100-01 Parameter error in {{ISBN}}: checksum-5

I have tried unsuccessfully to locate the correct ISBN on the Internet. Knife-in-the-drawer (talk) 04:07, 17 May 2015 (UTC)

Because it is causing a Checkwiki error #72: "ISBN-10 with wrong checksum", I removed the ISBN from the entry:

Dhyanalinga: The Eternal Form, ISBN 81-87910-12-1 Parameter error in {{ISBN}}: checksum

I have tried unsuccessfully to locate the correct ISBN on the Internet. Knife-in-the-drawer (talk) 05:36, 26 May 2015 (UTC)

Factual accuracy, neutrality tags?

Lots of tags have been added to the page in July 2016 about factual accuracy and lack of neutrality, but there seems to be no discussion or even an attempt at one on the talk page. Can the user who left these tags or anyone else please begin the discussion as to why these were applied.Regstuff (talk)

  • It's been 10 days and no discussion. So removing the tags. If anyone sees any issues in the article that need to be resolved, please put it up for on this page for discussion.Regstuff (talk) 14:38, 22 August 2016 (UTC)
    • I wasn't the earlier tagger, but I do think some of the tags may have been somewhat warranted. For sure the article's overall tone is still very autobio/fan-ish. (Unfortunately there's isn't a WP:AUTOBIO-FAN-ISH template :-) ) I dunno -- if it's failing WP:NPOV, it's only just over the line and I'm not sure it deserves a tag. Could we perhaps just do a bit of "neutralification" (if that's not a word, it should be) as we prune here and there. As a start, I just shoved a {{Better source}} onto the opening sentence, which currently points only to sadhguru.org. Sleety Dribble (talk) 00:43, 3 October 2016 (UTC)

Unnecessary content deletion by User:IndianEditor, bias suspected.

It has come to my notice that the user named "IndianEditor" has been removing properly cited content quoting flimsy reasons. I added a sentence to the "Rally for Rivers" section providing info on the vehicle that Sadhguru is using in the rally. That is information very pertinent to the rally, and there is no valid reason to remove it.

I went through the edit history, and the same user also deleted the entire controversy section. I strongly suspect that the said user is extremely biased in his opinions. I will look into restoring the controversies section with properly cited material if and when I have free time. — Preceding unsigned comment added by HakunaMatata1993 (talkcontribs) 18:14, 19 September 2017 (UTC)

Isn't this "The Quint" a tabloid? I think it's somewhat nosense criticism. This was about preventing river pollution. CO2 is natural nontoxic gas essential for plant growth. Clothes manufacture and washing also an environmental burden.. should he have went the rally by foot and naked? —Mykhal (talk) 16:31, 19 September 2017 (UTC)

This isn't a debate forum. As long as a submission is backed by proper citations and is relevant to the topic, it shouldn't be vandalized. If you have an alternate article disproving the Quint report, feel free to quote the study and cite the article. Also, if you actually read the wiki article on CO2, you could realize how reducing CO2 emissions is essential for environment protection. 210.94.41.89 (talk) 11:12, 20 September 2017 (UTC)

Plagiarized?? And well, why not add this reference to all articles about environmental protection acts where their actors were not naked but clothed. By the way e.g. here one can discover that oceanic plastic waste pollution is more life threatening that carbon dioxide "pollution" (which I am not denying). Anyway, i'm unrelated to this, just wanted to express my undesranding of this particular IndianEditor's edit. —Mykhal (talk) 11:49, 20 September 2017 (UTC)
.. but i was unfortunately apparently misinformed what is the Rally about, now i understand the criticism more, and i'm abstaining from commenting this topic further. —Mykhal (talk) 23:27, 22 September 2017 (UTC)

Hi, my observations about User:IndianEditor is not limited to that particular edit, but his entire edit history on this article. In this particular case, I don't want to be a party to the debate on merits of Quint's criticism. The fact that this criticism exists is a piece of information relevant to the topic. In fact, I'd say this is the most relevant piece of criticism on Rally for Rivers, and has been quoted by multiple other news outlets too. That merits a mention in the wiki article on the same. HakunaMatata1993 (talk) 15:32, 20 September 2017 (UTC)

IndianEditor has been blocked. Joshua Jonathan -Let's talk! 04:39, 9 October 2017 (UTC)

Page issue

1 page issue is listed as

"This article contains content that is written like an advertisement. (June 2017)"

As far as I read article I didn't find anything like that So I think it should be removed GhostProducer (talk) 20:02, 30 September 2017 (UTC)

Duplicacy of Rally for Rivers

Two similar versions of Rally for Rivers currently exists - one as a section in this page and another as a section in Isha Foundation. Should we remove the section from one of the pages and link the references to the section in the other page, in order to avoid redundancy? As the Isha Foundation is working for the rally as a team, I suggest we maintain the section in the Isha Foundation page and refer to that section from this page wherever necessary. @GhostProducer: the last manual change to the section on Isha Foundation page was recently made by you, what's your opinion? If no one has objection, we'll go ahead with deleting the section here in a week's time - on 9th October? - Sbhtta (talk) 20:13, 1 October 2017 (UTC)

@Sbhtta: Hey there buddy First of all you are doing tremendous job 😊and as far as your message is concerned I suggest we should keep it on both pages with different text .And the Comment is made by Sadhguru as well as Isha Foundation.So its important to keep it on both pages. And one more thing is that number of celebrities should be reduced in Rally for Rivers section. What do you think about that.😉😉

@GhostProducer: Agreed, we can maintain different points of discussion and quotes on this page and the Isha Foundation page, depending upon the context of the entity being referenced in the sources. I also agree that the number of celebrities named explicitly in this section can be reduced. But I don't have a criterion for which names to keep and which to remove. Maybe we can bunch the names by the sources and quote only a couple of names from each source to reduce the number. I'll do that? - Sbhtta (talk) 16:50, 2 October 2017 (UTC)

@Sbhtta: Ok then we should keep it on both pages with different text. And as Celebrities are concerned I think we should keep 2 -2 names of Politicians, Celebrities, Cricketers etc etc. As we don't have any rule for that. And it would cover every sector. And If you have any other suggestion please do tell that. Thanks GhostProducer (talk)

@Sbhtta: What do you think ???? Should I proceed deleting some names in Rally for Rivers Section. GhostProducer (talk)

@GhostProducer: Yes, that'll be great. Thanks! - Sbhtta (talk) 10:44, 4 October 2017 (UTC)

Ping

@Sitush: have you got some appetite to take up your broom and clean-out this article? Joshua Jonathan -Let's talk! 04:40, 9 October 2017 (UTC)

As I said some years ago, as far as I am concerned the guy is a charlatan and his supporters are idiots for being deceived by him. I am way too biassed to do much here. - Sitush (talk) 07:56, 9 October 2017 (UTC)

Osho

@Borris83: maybe you're right that Jaggi Vasudev is an avid reader of Osho diff diff, but Quaora and blogs are not the right kind of sources for such statements. Joshua Jonathan -Let's talk! 06:04, 14 October 2017 (UTC)

But it's interesting what a Google-search on "Jaggi Vasudev" "osho" presents, like this. Reminds me of some western guru's who offer expensive short-cut tours to enlightenment. Joshua Jonathan -Let's talk! 06:11, 14 October 2017 (UTC)


Science

@Iamgod12345: Can you please explain the issues you have with the sources I used in the science section. Reverted by you here - https://en.wikipedia.org/search/?title=Jaggi_Vasudev&diff=808142516&oldid=808142052 One of the source is a well referenced blog post. The other is a search result of sadhguru's own website.

Others reading this please do chime in on how you feel about having a section on Sadhguru's views on science. Charsikid (talk) 04:14, 1 November 2017 (UTC)

@Charsikid: Have a look at this: https://en.wikipedia.org/Wikipedia:Blogs_as_sources Iamgod12345 (talk) 17:09, 1 November 2017 (UTC)

@Iamgod12345: The blog I used is not a personal blog and not hosted on a generic platform. It is part of an organisation's domain and the writing is quite technical and well cited. Does this not make the source credible enough? For the benefit of other readers. This is the source URL in question - http://nirmukta.com/2012/07/26/jaggi-vasudev-doesnt-understand-science-or-the-nature-of-the-universe Charsikid (talk) 15:21, 1 November 2017 (UTC)

@Charsikid:

According to Misplaced Pages policies: Never use self-published books, zines, websites, web forums, blogs, and tweets as a source for material about a living person unless written or published by the subject of the biographical material

If you will read the article you will see the author has given his opinions which is against the policies of Misplaced Pages.

And the author is not expert in religion area and has written 1 article since 2012 which makes me doubt the author.

If you will read some articles on the http://nirmukta.com you will find the whole Website is biased towards Hinduism and works like a propaganda-like Islamic Websites nowadays are against Indian religions and are spreading fake information.

I really doubt who host the Website Iamgod12345 (talk) 17:09, 1 November 2017 (UTC)

@Iamgod12345: Currently the nirmukta article is the most comprehensive piece I have found outlining the contradictions and misconceptions in Sadhguru's views on science. It would have been useful to have a more mainstream sources in addition to this but I am struggling to find them since Sadhguru's own websites have spammed the terms 'science', 'engineering' etc. I will come back to this in a few days.

I think having a section on science and Sadhguru's views on it will be worthwhile to balance out the article a little bit. Need input from other contributers on this. Charsikid (talk) 23:16, 1 November 2017 (UTC)

@Charsikid: This article is already balanced and there is rarely any source supporting your Section Science. I too tried to find it but what I found were personal blogs and nothing. Iamgod12345 (talk) 03:02, 2 November 2017 (UTC)

Hinduism or not

Can we please get some consensus on the issue of Jaggi's religion ? There seem to be frequent edits just going to and fro between 'Hinduism' and 'None'. While Sadhguru has himself claimed to follow no religion some of the sermons I have seen from him do borrow a lot from Hinduism. He also is involved with a 'shivalinga' statue construction. Charsikid (talk) 04:25, 1 November 2017 (UTC)

He is Agnostic. You May Conceive it by Reading his Article On 'Sprituality'. David Tim (talk) 16:14, 9 November 2017 (UTC)

According to Oxford Dictionary Agnostic means

A person who believes that nothing is known or can be known of the existence or nature of God.

But my friend he never said one can't know the Ultimate Truth. Right from 1992, he is Saying By Yoga you can know the Ultimate Truth.

Your Statement has no meaning Iamgod12345 (talk) 18:19, 9 November 2017 (UTC)

When Did he Say That he Follows Hinduism? Why don't you Keep It to None,Rather than Branding him With Hinduism? David Tim (talk) 01:59, 10 November 2017 (UTC)

Read my comment here Iamgod12345 (talk) 14:33, 10 November 2017 (UTC)

What an idiot you are,he has also been influenced by Buddhism,does that make his Religion as Buddhism?

David Tim (talk) 05:09, 11 November 2017 (UTC)

He is either Agnostic or None. David Tim (talk) 05:10, 11 November 2017 (UTC)

I don't understand what are you smoking. If he doesn't tech Hindu teachings then what did he teach huh????? Islamic Teachings??? Iamgod12345 (talk) 06:43, 11 November 2017 (UTC)

Please Read my Comment over here - https://en.m.wikipedia.org/Jaggi_Vasudev#/talk/15 David Tim (talk) 07:41, 11 November 2017 (UTC)

References

  1. https://en.oxforddictionaries.com/definition/agnostic

Sadhguru's Religion

This Discussion was meant for 'Iamgod12345' I don't know why ignorant people like Iamgod12345 are Allowed to stay on Misplaced Pages. His teachings are not only based on Hinduism but also on Buddhism,Self Exploration/Experience and many more. Now does that make him a Hindu??? If Yes,then I think I should Create an Article on Ignorant People! And for God sake,please stop Editing the Article repeatedly. — Preceding unsigned comment added by David Tim (talkcontribs) 07:35, 11 November 2017 (UTC)

He teaches his Kriya Yoga. And that's not in Buddhism. It's in Hinduism and I already said His all work revolves around Hinduism. Eg. Shiva Lingam, Lingam Brhavai, Dhayana Lingam. He doesn't teach Buddha's way. His teachings are influenced by Shiva. Please don't edit again and again or you will be blocked. Anmolbhat (talk) 08:18, 11 November 2017 (UTC)

Please remember u can't edit more than 3 to times a day Anmolbhat (talk) 08:19, 11 November 2017 (UTC)

Please don't change it again and again. As I said He teaches Kriya Yoga Iamgod12345 (talk) 08:40, 11 November 2017 (UTC)

Hey,Both you Indian fools. Does he Only Teach 'Kriya Yoga'? Isn't it a lot more than that? Being an Indian I can Conclude that 'Indian Ignorance' is the highest Level of Ignorance an Ignorant Person can Reach. Please back up Your Stupid Claims Before Talking Like an Idiot. And Who said he Doesn't Teach Buddha's Way And Only Shiva's way.There are Videos all Around the Internet where he Shows Buddha's way. So Please Die,the Earth doesn't Require the Existence of Arrogant Fools.


David Tim (talk) 12:28, 11 November 2017 (UTC)

And For Fuck Sake Stop Editing again and again. David Tim (talk) 12:29, 11 November 2017 (UTC)

Why Don't You just Accept the Fact that he has nothing to do with Religion.Please Stop Claiming that he Follows Hinduism Without any Proper Backup!

47.29.56.93 (talk) 12:44, 11 November 2017 (UTC)

External links modified

Hello fellow Wikipedians,

I have just modified one external link on Jaggi Vasudev. Please take a moment to review my edit. If you have any questions, or need the bot to ignore the links, or the page altogether, please visit this simple FaQ for additional information. I made the following changes:

When you have finished reviewing my changes, you may follow the instructions on the template below to fix any issues with the URLs.

This message was posted before February 2018. After February 2018, "External links modified" talk page sections are no longer generated or monitored by InternetArchiveBot. No special action is required regarding these talk page notices, other than regular verification using the archive tool instructions below. Editors have permission to delete these "External links modified" talk page sections if they want to de-clutter talk pages, but see the RfC before doing mass systematic removals. This message is updated dynamically through the template {{source check}} (last update: 5 June 2024).

  • If you have discovered URLs which were erroneously considered dead by the bot, you can report them with this tool.
  • If you found an error with any archives or the URLs themselves, you can fix them with this tool.

Cheers.—InternetArchiveBot (Report bug) 00:04, 20 November 2017 (UTC)

Removal of content

Hello fellow Wikipedians,

  • The reason I am removing the Critisism here is because of WP:BLPSPS. Now The Quint is not self Published source but as WP:BLPSPS says

Some news organizations host online columns that they call blogs, and these may be acceptable as sources so long as the writers are professionals. We can't add criticism because the author's are not professional.

  • And as far as this is concerned. According to WP:BLPCRIME(For relatively unknown people, editors must seriously consider not including material—in any article—that suggests the person has committed, or is accused of having committed, a crime, unless a conviction has been secured. A living person accused of a crime is presumed innocent until convicted by a court of law. Accusations, investigations and arrests do not amount to a conviction).So let the case get solved and then we will add that. It also voilates WP:LPNAME as said by policy: Caution should be applied when identifying individuals who are discussed primarily in terms of a single event. When the name of a private individual has not been widely disseminated or has been intentionally concealed, such as in certain court cases or occupations, it is often preferable to omit it.This happened in case of his wife.It also voilates WP:PUBLICFIGURE because there are not multiple sources as one can see here the only thing we can get in hands are blogs. As said by policy : If you cannot find multiple reliable third-party sources documenting the allegation or incident, leave it out.
  • And for this . It goes same as previous.

As this a Article of living person we should not take chance.Anmolbhat (talk) 16:31, 22 December 2017 (UTC)

External links modified

Hello fellow Wikipedians,

I have just modified one external link on Jaggi Vasudev. Please take a moment to review my edit. If you have any questions, or need the bot to ignore the links, or the page altogether, please visit this simple FaQ for additional information. I made the following changes:

When you have finished reviewing my changes, you may follow the instructions on the template below to fix any issues with the URLs.

This message was posted before February 2018. After February 2018, "External links modified" talk page sections are no longer generated or monitored by InternetArchiveBot. No special action is required regarding these talk page notices, other than regular verification using the archive tool instructions below. Editors have permission to delete these "External links modified" talk page sections if they want to de-clutter talk pages, but see the RfC before doing mass systematic removals. This message is updated dynamically through the template {{source check}} (last update: 5 June 2024).

  • If you have discovered URLs which were erroneously considered dead by the bot, you can report them with this tool.
  • If you found an error with any archives or the URLs themselves, you can fix them with this tool.

Cheers.—InternetArchiveBot (Report bug) 17:19, 29 December 2017 (UTC)

Jaggi Vasudev's Great Grandmother who Fed Ants in the 60's/70's: 'a devil of a woman'

Jaggi Vasudev has used a story about the seemingly unusual behavior of one of his great grandmothers in his talks on numerous occasions. I think it would be interesting to know something about this person: is there any source from the 1960's or 1970's (or after) that says there was a supercentenarian in the Mysuru area? Being 113 or 114 years of age at death is a news-making claim, and I would imagine that the newspapers would probably document the peculiarities of this person's life as well. Starting from the most literal interpretation of the claim, who were his grandparents (and step-grandparents, if any) through his parents Dr. Vasudev and Susheela? I imagine that some of this information should be in the public record. Once we know that, then we can see if any of his four great grandmothers (or any potential step-great grandmothers) seem consistent with this story. If none of them match, then maybe this story is based on the story of a person from the area who lived to old age. Whatever the facts are, it would be interesting to know more. Geographyinitiative (talk) 07:57, 16 February 2018 (UTC)

Philosophy

There needs to be a philosophy section here. Sadhguru is not in the tradition of astika by not believing in any scriptures. I think that is a very significant deviation of standard yogic tradition.--2A02:8388:3C1:4480:7C79:BFB0:AFE4:F7A1 (talk) 22:28, 23 September 2018 (UTC)

Please fix wrong link

Where it says Pranayam should say Pranayama and the link should go to: https://en.wikipedia.org/Pranayama 23.240.1.247 (talk) 04:57, 17 October 2018 (UTC)

 Done: I have made the correction. Thank you --NicoScribe (talk) 09:08, 17 October 2018 (UTC)

Requested move 20 October 2018

The request to rename this article to Sadhguru has been carried out.
If the page title has consensus, be sure to close this discussion using {{subst:RM top|'''page moved'''.}} and {{subst:RM bottom}} and remove the {{Requested move/dated|…}} tag, or replace it with the {{subst:Requested move/end|…}} tag.

Jaggi VasudevSadhguru – Article has recently been boldly moved because Sadhguru is supposedly a title rather than a name. However, nearly all sources that are mentioned in the references mention "Sadhguru" instead of to "Jaggi Vasudev" so Sadhguru serves apparently as the common name. Marcocapelle (talk) 20:17, 20 October 2018 (UTC) --Relisting. В²C 18:05, 30 October 2018 (UTC)

  • Oppose I was the person who performed the aforementioned move. I was, however, undoing another bold move made in August. Re: Marcocapelle's point about nearly all sources that are mentioned in the references mention "Sadhguru" instead of to "Jaggi Vasudev", this is mainly due to an editor doing a find and replace on October 1 which also changed the citation titles. Sadhguru is an honorific. FWIW, this article is currently a puff piece and not neutral at all. See also: my merge request over at Isha Foundation, a lot of which has been duplicated here.—Cpt.a.haddock (talk) (please ping when replying) 15:30, 22 October 2018 (UTC)
Update: Since there are editors supporting this move, let me expand:
Sadhguru is an innnacurate transliteration of सद्गुरु or "good guru". A correct transliteration would be Sadguru (which redirects on Misplaced Pages to Satguru, something of a Hindi variant). Considering Jaggi Vasudev's international market, Sadguru is liable to be misread and mispronounced as "Sad Guru" which is likely what led to the use of Sadhguru. Jaggi's Hindi article correctly uses सद्गुरु (Sadguru) rather than सध्गुरु (Sadhguru).
There are and have been thousands of people in history who are considered Sadgurus and named using the honorific. As Satguru attests, Kabir is often addressed with a combination (or subset thereof) involving "Sant Samrat Satguru Kabir Sahib". The website of one of his "dhams" is at sadgurukabirprakatyadhamlahartaravaranasi.com. There is the contemporary Shri Sadguru Seva Sangh Trust (SSSST) aka the Sadguru Trust which refers to a Sadguru named Param Pujya Shri Ranchhoddasji Maharaj. Incidentally, this Sadguru is also known as "Gurudev" which also refers to another contemporary godman, Sri Sri Ravi Shankar, i.e., Ravi Shankar (spiritual leader) as well as Rabindranath Tagore and many others and often used as an honorific prefix. A cursory look through Misplaced Pages unearthed these other Sad(h)gurus:
* Sadguru Appayya Swamy
* Sadguru Hambir Baba
* Shreedhar Swami: aka "Sadguru Bhagwan Shreedhar Swami Maharaj"
* Jangali Maharaj, also known as Sadguru Jangali Maharaj or Guru Maharaj
* Samartha Sadguru, a TV serial about Sai Baba of Shirdi
* Sadikshah Qadri, aka "Sadguru Sadikbaba"
* Shri Sadguru Nityanand High School, named after Sadguru Nityanand, aka Bhagawan Nityananda (with Bhagawan being another honorific)
* Vihangamyoga: "Vihangam Yoga is an ancient meditation technique practiced by Indian seers and sages. In the current time, it is established by Sadguru Sadafaldeo Ji Maharaj."
This is the tip of the iceberg in terms of the number of people referred to as Satguru or Sadguru and prefixed with these terms listed on Misplaced Pages alone. In other words, Satguru and Sadguru are honorifics and the variant, Sadhguru should be treated as the same. Even if otherwise, current news articles still routinely refer to Jaggi Vasudev without mentioning "Sadhguru", and if they do mention the title, they clarify which Sadguru they are talking about in the body. Furthermore, the use of the term has been popularised only recently. Anecdotally, old reports rarely insisted on the term. This 2001 interview with Vasudev quotes him saying, ‘I drive my own car, people still call me by my first name. I don’t act like a heavenly being. What else can I do to make it normal?’ asks Jaggi Vasudev.—Cpt.a.haddock (talk) (please ping when replying) 11:56, 26 October 2018 (UTC)
See for example this source and this and this one. Marcocapelle (talk) 18:59, 22 October 2018 (UTC)
One of those is a book by his follower (who would refer to her guru solely by his title). The other two are duplicates of each other. I thought my revert would clarify your point about "nearly all sources"; compare mentions of Jaggi Vasudev in the reference section before and after my revert earlier today to get an idea.—Cpt.a.haddock (talk) (please ping when replying) 19:23, 22 October 2018 (UTC)
  • Move Sadhguru seems to be the comonly used name, not just by his followers but by global bodies also. See UN's program schedule (pdf) & UN Environment (which ironically links back to this wiki page). Some examples from news: , . And some examples from institutions: London Science Museum, Harvard Keynote Talk. Also, the fact that the word Sadhguru is an honorific shouldn't come in the way of the move. The original move was performed as per Commonly Used Name policy because most people know him as Sadhguru not Jaggi Vasudev. When people call him Sadhguru, they are not using the word as an honorific but more as a name for the person. Madrasiman (talk) 16:45, 25 October 2018 (UTC)
And here are the promotional links for the UN, Harvard, Yale, Dartmouth, and Rice calling him "Jaggi Vasudev" or "Sadhguru Jaggi Vasudev". Similar news articles are listed in many other comments in this RM. And when people call him "Sadhguru" they are using the honorific else they, news articles, and even his own organisations would not be referring to him largely as "Sadhguru Jaggi Vasudev" if not "Jaggi Vasudev".—Cpt.a.haddock (talk) (please ping when replying) 15:00, 31 October 2018 (UTC)
That appears to be rather arbitrary. Here are two recent reports from your chosen publications which don't mention "Sadhguru" at all.—Cpt.a.haddock (talk) (please ping when replying) 08:12, 26 October 2018 (UTC)
Please provide evidence to support your position. Thanks.—Cpt.a.haddock (talk) (please ping when replying) 10:00, 29 October 2018 (UTC)
Count the search results on Google search and Google news. This scholarly book also called him "Sadhguru" as more common name, not "Jaggi Vasudev". Raymond3023 (talk) 15:36, 29 October 2018 (UTC)
Those statistics are up to you to document here along with the necessary caveats to support your claim that "Sadhguru" is Jaggi Vasudev's name. Jaggi Vasudev has been the title of this article from October 2006; the burden is on you to prove otherwise. And IMO, your contention is incorrect. Re: the one book that you've mentioned: while Arundhati Subramaniam's book was (published by Penguin) can be used as a source for this article, she also happens to be his disciple. IOW, Jaggi Vasudev is her guru, her Sadguru. She is incidentally also his co-author in other books, a ghost writer, if you will. Thanks.—Cpt.a.haddock (talk) (please ping when replying) 15:58, 29 October 2018 (UTC)
67k results in Google news for "Sadhguru" and 17k results for "Jaggi Vasudev". Though the results comparison on Google books and normal Google search shows bigger difference between these two names. Since "Jaggi Vasudev has been the title of this article from October 2006", it is obvious that many results on Google for "Jaggi Vasudev" are just mirroring Misplaced Pages. Raymond3023 (talk) 16:21, 29 October 2018 (UTC)
Guys WP:GOOGLEHITS is not a strong argument, much of it is muddied with tweets and other meaningless results. --DBigXrayᗙ 16:49, 29 October 2018 (UTC)
This is why I mentioned "Google news", which reports only those things that were covered by news sites than social networking and other unreliable sites. Raymond3023 (talk) 16:58, 29 October 2018 (UTC)
Please provide a link or a screenshot for this. Google News does not display result counts for me. Thanks.—Cpt.a.haddock (talk) (please ping when replying) 14:36, 31 October 2018 (UTC)
  • Oppose I note that the subject and his followers like to call him Sadhguru which is indeed a WP:Honorific, his twitter account and websites etc use the same, which explains Google hits, But Mainstream media still uses his name "Jaggi Vasudev" . For Example this book in its intro says "This is the extraordinary story of Jaggi Vasudev or Sadhguru". It does not state "This is the extraordinary story of Sadhguru or Jaggi Vasudev" or "This is the extraordinary story of Sadhguru". Note the order of the mention of the two names here, which comes first and which second. It is a good example to judge the common name by this intro. I think This article should continue to stay at Jaggi Vasudev.--DBigXrayᗙ 16:56, 29 October 2018 (UTC)
How mainstream news and scholarly sources can be defined as "subject and his followers"? That seems to be in alphabetical in order, but the book title is "Sadhguru" and so should be our article. This is the only website (an unreliable source) that calls him "Jaggi Vasudev", rest calls him "Sadhguru" while some calls him "Sadhguru Jaggi Vasudev". That is entirely opposite to WP:COMMONNAME which requires more hits in reliable sources. Raymond3023 (talk) 17:05, 29 October 2018 (UTC)
Raymond, you have to understand that he has an Entire Public Relations department handling his PR, much of what you find online will also be a part of his PR, it becomes very difficult to sperate what is a PR vs what is non PR. I just pointed an observation that should help us in deciding. If you want to base your opinions on material related to his PR excercise, it is entirely your choice, and does not reflect the reality but just your opinion. The reliable media Either uses Full name including honorifics or just uses Jaggi Vasudev in its content.--DBigXrayᗙ 17:18, 29 October 2018 (UTC)
  • Comment. Yesterday, I found this discussion listed in the WP:RM backlog and closed it, finding a consensus to move Jaggi Vasudev to Sadhguru: Consensus is that Sadhguru (with the h) is used as a common name for this person and is not an honorific spelled this way in reference to this particular person. Subsequently, it was brought to my attention that despite being in the backlog, discussion here was still active. Indeed, a comment had been made about three hours prior to my close. I had not noticed that when I closed (my apologies for that), and so now have decided to revert my close to allow discussion to continue, and am relisting the request.
That said, I urge participants to recognize that nobody here is suggesting WP:HONORIFIC be ignored in this case; the issue is whether Sadhguru (with an h) is an honorific, or, if it is an honorific but (with the h) used exclusively to refer to this one person and so strongly associated with him that HONORIFIC allows it be used as article title, or should allow it. Again, this issue looked settled to me, but I see no harm in allowing discussion to continue. If I were participating I would want to see evidence showing that Sadhguru (with an h) is or is not used as an honorific for other persons, which name is used most commonly in reliable English sources, etc. --В²C 18:05, 30 October 2018 (UTC)
I'm posting my argument against this here rather than adding to my earlier reply which apparently very few read.
  1. As detailed in my primary reply, there are plenty of Sadgurus in India, both past and present. Sadhguru and Sadguru are homophonous in India. A not insignificant number of people and sources spell Vasudev's title as Sadguru. There are also sources that spell it Satguru. That said, Sadhguru is the more prevalent spelling for this Sadguru by far. But it explains how these variants are all treated synonymously. (Incidentally, most local language sources and media transliterate his title as Sadguru.)
  2. Yes, Sadguru and its variants are honorifics as explained in my primary reply. Sadhguru is also Jaggi Vasudev's honorific. The use of honorifics in titles violates WP:NCINDIC. If "Sadhguru" were his new mononym and a commonname understood by all, then he would largely be referred to in reliable sources only as "Sadhguru". On the contrary, when his title is used in reliable sources, it is commonly collocated before his name as "Sadhguru Jaggi Vasudev". Similarly, when sources only use Sadhguru in the headline, the article itself clarifies which Sadhguru is being talked about by giving his full name. Many also refer to him as "the Sadhguru". These are indicative of its honorific nature and its inefficacy as a COMMONNAME on its own.
  3. Jaggi Vasudev's Padma Vibhhushan in 2017 is noted prominently in this article's lede. The Ministry of Home Affairs notification officially credits the recipient of this award as "Sadhguru Jagadish Vasudev, Spiritualism, Tamil Nadu". If you correlate this entry with the adjacent ones, you will find that "Sadhguru" is being used as a title. (Jaggi is short for Jagadish.)
  4. The COMMONNAME in reliable sources argument: Google classifies (1, 2) news related to Jaggi Vasudev under the topic "Jaggi Vasudev" rather than "Sadhguru" or even "Sadhguru Jaggi Vasudev". As outlined by others, news articles continue to refer to him as Jaggi Vasudev or as Sadhguru Jaggi Vasudev. As before, when they do use only "Sadhguru" in the headline, they elaborate in the body to indicate which Sadhguru they are talking about. Note also that the use of his title particularly in headlines is a relatively recent phenomenon. You can see the change by browsing this archive backwards.
To conclude, "Sadhguru" is an honorific. But it is not this subject's common name. One could argue that "Sadhguru Jaggi Vasudev" is the common name, but that implicitly admits that Sadhguru is an honorific and therefore, violates WP:NCINDIC. Jaggi Vasudev is the subject's common name as well as his actual name. It has also been this article's title since 2006 and should remain so. Thanks.—Cpt.a.haddock (talk) (please ping when replying) 14:33, 31 October 2018 (UTC)
I will note here that I am in agreement with all the points noted by Cpt above. --DBigXrayᗙ 14:43, 31 October 2018 (UTC)
  • Strong Oppose of course not, verbatim: Cpt.a.haddock sums it up well. Sadhguru is an honorific and it violates Misplaced Pages:Naming_conventions_(Indic)#Titles_and_honorifics per LeoFrank - see also local newspapers which treat this BLP (born 1957) without honorific by real name "Jaggi Vasudev" Jaggi Vasudev’s interaction with FTII Pune students cancelled, or with honorific + real name "Satguru Jaggi Vasudev". In ictu oculi (talk) 12:45, 31 October 2018 (UTC)
  • Comment in continuation of my Oppose vote above, I find that it is wrongly been claimed that Sadhguru is his most COMMONLY used name. This is not true. The subject is still commonly known as Jaggi Vasudev in the reliable mainstream media. BBC called Jaggi Vasudev, Express UK called "Sadhguru Jaggi Vasudev".The word Sadhguru comes from "Satya" (truth) and (Guru) teacher, so it actually means, True Teacher, (as opposed to lots of Fake teachers out there). And it is interesting that This person likes to use the word for himself, kind of self glorification I would say. В²C In South Indias regional languages, it is quite common to add an extra h to Hindi words that have the letter t, So Satguru becomes a Sathguru/sadhguru. Sadhguru is actually a common name for Indian Gurus or spiritual leaders. Using this word to exclusively refer to Jaggi Vasudev is also inappropriate. Gnanananda Giri is another such example, he is popularly known as Sadguru Sri Gnanananda but our article does not mention Sadguru in the title. --DBigXrayᗙ 14:32, 31 October 2018 (UTC)
    • I remain neutral. We can find plenty of examples of sources using either name but not the other to refer to this person, but the relevant question is which is used most often to refer to him?. To that end, it's interesting to WP:GOOGLETEST sadhguru -vasudev and vasudev -sadhguru for which I get 6.3M and 4M hits respectively, suggesting sadhguru is the most common. Unless, some of those references to sadhguru are not to this person, but I've yet to find a single such example. --В²C 18:25, 31 October 2018 (UTC)
FYI, Vasudev is a commonly found name in this country and makes that comparison rather pointless. Anyhow, as noted in my spiel, you should also be considering both "Sadhguru Jaggi Vasudev" and "Sadhguru" and "Jaggi Vasudev" which indicate that the term is being used as an honorific. This however does not really solve the current problems inherent with Google searches for such comparisons. This is because:
  1. Google search might return a result count, but you can only browse an insignificant percentage of them. AFAICT, you are limited to 10–11 pages or 100–110 results. There are similar limitations for Bing, Duckduckgo, etc. So you can't really check if there are false positives. Even in the first link you have provided, what I see is that the last 2 pages (i.e., 9, 10) are essentially full of links from shaded.davemejiamasonry.com.
  2. Google also considers and returns results in Indic languages although this might be region-dependant. And again, as noted in my spiels, when Jaggi Vasudev's title is transcribed into Hindi, it becomes सद्गुरु (i.e., Sadguru) or even सतगुरु (Satguru). IOW, Google also returns results for Sadguru and this includes all the Sadgurus and Satgurus out there as well as use of the word in songs and other media quite unrelated to any guru in particular. For example, page 8 of your search lists this page as it contains the song: तेरे चरणों में सतगुरु मेरी प्रीत हो भजन लिरिक्स (tere charanon mein satguru meri preet ho bhajan lyrics).
  3. And it's easy enough to find a number of references to other Sadhgurus besides Jaggi if you play with combinations of these honorifics. See for example, "Sadhguru+Swamigal" "Sadhguru Swamigal", "Sri+Sadhguru" "Sri Sadhguru", etc. There's even one resident here on Misplaced Pages: Sri Sadhguru Sadhu Laxman Rao Ji Maharaj.
  4. See also all the other limitations listed on WP:GOOGLETEST (which needs to be updated).—Cpt.a.haddock (talk) (please ping when replying) 16:42, 1 November 2018 (UTC)

Redirect Sadhguru like Sadguru to Satguru

Once the above RM is done there should be some discussion whether Sadhguru, which is only a spelling variant, should like Sadguru go to Satguru with a hatnote. Note that the Kannada spelling of Sadhguru does not even redirect to this guru on Kannada wikipedia, nor in Hindi hi:सद्गुरु, nor Tamil. In ictu oculi (talk) 12:49, 31 October 2018 (UTC)

  • Agree In South Indias regional languages, it is quite common to add an extra h to Hindi words that have the letter t, So Satguru becomes a Sathguru/sadhguru. Satguru should be a redirect target for Sadhguru. but because of Jaggi Vasudev, I am open to making Sadhguru a disambiguation page for the same. --DBigXrayᗙ 14:35, 31 October 2018 (UTC)
Are there any examples from reliable English sources using Sadhguru in place of Sadguru in a context that does not refer to Jaggi Vasudev? Any? Even if there are a few, if the vast majority of the uses of Sadhguru in reliable English sources refer to Jaggi Vasudev, then Sadhguru must at a minimum be a WP:PRIMARYREDIRECT to the article about him, as it currently is, and, barring the production of evidence to the contrary, should remain that way (if the above proposal is rejected). --В²C 17:42, 31 October 2018 (UTC)
Yes, obviously. More to the point; this is a BLP, this is not the place to push views on WP:SMALLDETAILS and other titling hobby horses. In ictu oculi (talk) 20:07, 31 October 2018 (UTC)
Categories:
Talk:Sadhguru: Difference between revisions Add topic